Skip to content

sr2silo

Wrangele BAM nucleotide alignments to cleartext alignments

Logo

Project Status: POC – This project is currently under active development. CI/CD Black Pytest Ruff Pyright

General Use: Convert Nucleotide Alignment Reads - CIGAR in .BAM to Cleartext JSON

sr2silo can convert millions of Short-Read nucleotide read in the form of a .bam CIGAR alignments to cleartext alignments. Further, it will gracefully extract insertions and deletions. Optionally, sr2silo can translate and align each read using diamond / blastX. And again handle insertions and deletions.

Your input .bam/.sam with one line as:

294 163 NC_045512.2 79  60  31S220M =   197 400 CTCTTGTAGAT FGGGHHHHLMM ...

sr2silo outputs per read a JSON (mock output):

{
  "metadata":{
    "read_id":"AV233803:AV044:2411515907:1:10805:5199:3294",
      ...
    },
    "nucleotideInsertions":{
                            "main":[10 : ACTG]
                            },
    "aminoAcidInsertions":{
                            "E":[],
                            ...
                            "ORF1a":[2323 : TG, 2389 : CA],
                            ...
                            "S":[23 : A]
                            },
    "alignedNucleotideSequences":
                                {
                                  "main":"NNNNNNNNNNNNNNNNNNCGGTTTCGTCCGTGTTGCAGCCG...GTGTCAACATCTTAAAGATGGCACTTGTGNNNNNNNNNNNNNNNNNNNNNNNN"
                                  },
    "unalignedNucleotideSequences":{
                                  "main":"CGGTTTCGTCCGTGTTGCAGCCGATCATCAGCACATCTAGGTTTTGTCCGGGTGTGA...TACAGGTTCGCGACGTGCTCGTGTGAAAGATGGCACTTGTG"
                                  },
    "alignedAminoAcidSequences":{
                "E":"",
                ...
                "ORF1a":"...XXXMESLVPGFNEKTHVQLSLPVLQVRVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGVXXXXXX...",
                ...
                "S":""}
      }

The total output is handled in an .ndjson.zst.

Resource Requirements

When running sr2silo, particularly the process-from-vpipe command, be aware of memory and storage requirements:

  • Standard configuration uses 8GB RAM and one CPU core
  • Processing batches of 100k reads requires ~3GB RAM plus ~3GB for Diamond
  • Temporary storage needs (especially on clusters) can reach 30-50GB

For detailed information about resource requirements, especially for cluster environments, please refer to the Resource Requirements documentation.

Wrangling Short-Read Genomic Alignments for SILO Database

Originally this was started for wargeling short-read genomic alignments for from wastewater-sampling, into a format for easy import into Loculus and its sequence database SILO.

sr2silo is designed to process a nucliotide alignments from .bam files with metadata, translate and align reads in amino acids, gracefully handling all insertions and deletions and upload the results to the backend LAPIS-SILO.

For the V-Pipe to Silo implementation we carry through the following metadata:

  "metadata":{
    "read_id":"AV233803:AV044:2411515907:1:10805:5199:3294",
    "sample_id":"A1_05_2024_10_08",
    "batch_id":"20241024_2411515907",
    "sampling_date":"2024-10-08",
    "sequencing_date":"2024-10-24",
    "location_name":"Lugano (TI)",
    "read_length":"250","primer_protocol":"v532",
    "location_code":"05",
    "flow_cell_serial_number":"2411515907"
    "sequencing_well_position":"A1",
    "primer_protocol_name":"SARS-CoV-2 ARTIC V5.3.2",
    "nextclade_reference":"sars-cov-2"
    }

Setting up the repository

To build the package and maintain dependencies, we use Poetry. In particular, it's good to install it and become familiar with its basic functionalities by reading the documentation.

Installation

sr2silo can be installed either from Bioconda or from source.

Install from Bioconda

The easiest way to install sr2silo is through the Bioconda channel:

# Add necessary channels if you haven't already
conda config --add channels defaults
conda config --add channels bioconda
conda config --add channels conda-forge

# Install sr2silo
conda install sr2silo

Install from Source

For development purposes or to install the latest version, you can install from source using Poetry:

The project uses a modular environment system to separate core functionality, development requirements, and workflow dependencies. Environment files are located in the environments/ directory:

Core Environment Setup

For basic usage of sr2silo:

make setup
This creates the core conda environment with essential dependencies and installs the package using Poetry.

Development Environment

For development work:

make setup-dev
This command sets up the development environment with Poetry.

Workflow Environment

For working with the snakemake workflow:

make setup-workflow
This creates an environment specifically configured for running the sr2silo in snakemake workflows.

All Environments

You can set up all environments at once:

make setup-all

Additional Setup for Development

After setting up the development environment:

conda activate sr2silo-dev
poetry install --with dev
poetry run pre-commit install

Run Tests

make test
or
conda activate sr2silo-dev
pytest

Run CLI

The sr2silo CLI has three main commands:

  1. run - Not yet implemented command for future functionality
  2. process-from-vpipe - Process V-Pipe BAM alignments to SILO format (processing only)
  3. submit-to-loculus - Upload processed files to S3 and submit to SILO/Loculus

Two-Step Workflow

sr2silo follows a two-step workflow:

Step 1: Process V-Pipe data

sr2silo process-from-vpipe \
    --input-file INPUT.bam \
    --sample-id SAMPLE_ID \
    --batch-id BATCH_ID \
    --timeline-file TIMELINE.tsv \
    --primer-file PRIMERS.yaml \
    --output-fp OUTPUT.ndjson \
    --reference sars-cov-2

Step 2: Submit to Loculus

sr2silo submit-to-loculus \
    --processed-file OUTPUT.ndjson.zst \
    --sample-id SAMPLE_ID

Required Arguments for process-from-vpipe

  • --input-file, -i: Path to the input BAM alignment file
  • --sample-id, -s: Sample ID to use for metadata
  • --batch-id, -b: Batch ID to use for metadata
  • --timeline-file, -t: Path to the timeline metadata file
  • --primer-file, -p: Path to the primers configuration file
  • --output-fp, -o: Path for the output file (will be auto-suffixed with .ndjson.zst)

Required Arguments for submit-to-loculus

  • --processed-file, -f: Path to the processed .ndjson.zst file to upload and submit
  • --sample-id, -s: Sample ID for the processed file

Optional Arguments for process-from-vpipe

  • --reference, -r: Reference genome to use (default: "sars-cov-2")
  • --skip-merge/--no-skip-merge: Skip merging of paired-end reads (default: no-skip-merge)

Example Usage

Here's a complete example with sample data:

Step 1: Process V-Pipe data

sr2silo process-from-vpipe \
    --input-file ./data/sample/alignments/REF_aln_trim.bam \
    --sample-id "A1_05_2024_10_08" \
    --batch-id "20241024_2411515907" \
    --timeline-file ./data/timeline.tsv \
    --primer-file ./data/primers.yaml \
    --output-fp ./results/output.ndjson \
    --reference sars-cov-2

This will create a processed file ./results/output.ndjson.zst.

Step 2: Submit to Loculus

sr2silo submit-to-loculus \
    --processed-file ./results/output.ndjson.zst \
    --sample-id "A1_05_2024_10_08"

This will upload the processed file to S3 and submit it to SILO/Loculus.

Tool Sections

The code quality checks run on GitHub can be seen in - .github/workflows/test.yml for the python package CI/CD,

We are using:

  • Ruff to lint the code.
  • Black to format the code.
  • Pyright to check the types.
  • Pytest to run the unit tests code and workflows.
  • Interrogate to check the documentation.

Contributing

This project welcomes contributions and suggestions. For details, visit the repository's Contributor License Agreement (CLA) and Code of Conduct pages.