Skip to content

sr2silo

Wrangele BAM nucleotide alignments to cleartext alignments

Logo

Project Status: POC – This project is currently under active development. CI/CD Pytest Ruff Pyright

General Use: Convert Nucleotide Alignment Reads - CIGAR in .BAM to Cleartext JSON

sr2silo can convert millions of Short-Read nucleotide reads in the form of .bam CIGAR alignments to cleartext alignments compatible with LAPIS-SILO v0.8.0+. It gracefully extracts insertions and deletions. Optionally, sr2silo can translate and align each read using diamond / blastX, handling insertions and deletions in amino acid sequences as well.

Your input .bam/.sam with one line as:

294 163 NC_045512.2 79  60  31S220M =   197 400 CTCTTGTAGAT FGGGHHHHLMM ...

sr2silo outputs per read a JSON (compatible with LAPIS-SILO v0.8.0+):

{
  "readId": "AV233803:AV044:2411515907:1:10805:5199:3294",
  "sampleId": "A1_05_2024_10_08",
  "batchId": "20241024_2411515907",
  "samplingDate": "2024-10-08",
  "locationName": "Lugano (TI)",
  "locationCode": "5",
  "sr2siloVersion": "1.3.0",
  "main": {
    "sequence": "CGGTTTCGTCCGTGTTGCAGCCG...GTGTCAACATCTTAAAGATGGCACTTGTG",
    "insertions": ["10:ACTG", "456:TACG"],
    "offset": 4545
  },
  "S": {
    "sequence": "MESLVPGFNEKTHVQLSLPVLQVRVRGFGDSVEEVLSEARQHLKDGTCGLVEVEKGV",
    "insertions": ["23:A", "145:KLM"],
    "offset": 78
  },
  "ORF1a": {
    "sequence": "XXXMESLVPGFNEKTHVQLSLPVLQVRVRGFGDSVEEVLSEARQHLKDGTCGLV",
    "insertions": ["2323:TG", "2389:CA"],
    "offset": 678
  },
  "E": null,
  "M": null,
  "N": null,
  "ORF1b": null,
  "ORF3a": null,
  "ORF6": null,
  "ORF7a": null,
  "ORF7b": null,
  "ORF8": null,
  "ORF10": null
}

The total output is handled in an .ndjson.zst.

Resource Requirements

When running sr2silo, particularly the process-from-vpipe command, be aware of memory and storage requirements:

  • Standard configuration uses 8GB RAM and one CPU core
  • Processing batches of 100k reads requires ~3GB RAM plus ~3GB for Diamond
  • Temporary storage needs (especially on clusters) can reach 30-50GB

For detailed information about resource requirements, especially for cluster environments, please refer to the Resource Requirements documentation.

Wrangling Short-Read Genomic Alignments for SILO Database

Originally this was started for wrangling short-read genomic alignments from wastewater-sampling, into a format for easy import into Loculus and its sequence database SILO.

sr2silo is designed to process nucleotide alignments from .bam files with metadata, translate and align reads in amino acids, gracefully handling all insertions and deletions and upload the results to the backend LAPIS-SILO v0.8.0+.

Output Format for LAPIS-SILO v0.8.0+: - Metadata fields use camelCase naming (e.g., readId, sampleId, batchId) to align with Loculus standards - Metadata fields are at the root level (no nested "metadata" object) - Genomic segments use a structured format with sequence, insertions, and offset fields - The main nucleotide segment is required and contains the primary alignment - Gene segments (S, ORF1a, etc.) contain amino acid sequences or null if empty - Insertions use the format "position:sequence" (e.g., "123:ACGT")

Output Schema Configuration:

The output schema is defined in src/sr2silo/silo_read_schema.py using Pydantic models with field aliases for camelCase output. To modify the metadata fields:

  1. Edit src/sr2silo/silo_read_schema.py - Add/modify fields in ReadMetadata class
  2. Update resources/silo/database_config.yaml - Ensure field names match the Pydantic aliases
  3. Run validation: python tests/test_database_config_validation.py

The validation ensures your Pydantic schema matches the SILO database configuration.

For the V-Pipe to Silo implementation we include the following metadata fields at the root level:

{
  "readId": "AV233803:AV044:2411515907:1:10805:5199:3294",
  "sampleId": "A1_05_2024_10_08",
  "batchId": "20241024_2411515907",
  "samplingDate": "2024-10-08",
  "locationName": "Lugano (TI)",
  "locationCode": "5",
  "sr2siloVersion": "1.3.0"
}

Setting up the repository

To build the package and maintain dependencies, we use Poetry. In particular, it's good to install it and become familiar with its basic functionalities by reading the documentation.

Installation

sr2silo can be installed either from Bioconda or from source.

Install from Bioconda

The easiest way to install sr2silo is through the Bioconda channel:

# Add necessary channels if you haven't already
conda config --add channels defaults
conda config --add channels bioconda
conda config --add channels conda-forge

# Install sr2silo
conda install sr2silo

Install from Source

For development purposes or to install the latest version, you can install from source using Poetry:

The project uses a modular environment system to separate core functionality, development requirements, and workflow dependencies. Environment files are located in the environments/ directory:

Core Environment Setup

For basic usage of sr2silo:

make setup
This creates the core conda environment with essential dependencies and installs the package using Poetry.

Development Environment

For development work:

make setup-dev
This command sets up the development environment with Poetry.

Workflow Environment

For working with the snakemake workflow:

make setup-workflow
This creates an environment specifically configured for running the sr2silo in snakemake workflows.

All Environments

You can set up all environments at once:

make setup-all

Additional Setup for Development

After setting up the development environment:

conda activate sr2silo-dev
poetry install --with dev
poetry run pre-commit install

Run Tests

make test
or
conda activate sr2silo-dev
pytest

Usage

sr2silo follows a two-step workflow:

  1. Process data: sr2silo process-from-vpipe --help
  2. Submit to Loculus: sr2silo submit-to-loculus --help
# Example: Process V-Pipe data
sr2silo process-from-vpipe \
    --input-file input.bam \
    --sample-id SAMPLE_001 \
    --timeline-file timeline.tsv \
    --output-fp output.ndjson

# Example: Submit to Loculus (use environment variables for credentials)
export KEYCLOAK_TOKEN_URL=https://auth.example.com/token
export BACKEND_URL=https://api.example.com/submit
export GROUP_ID=123
export USERNAME=your-username
export PASSWORD=your-password

sr2silo submit-to-loculus --processed-file output.ndjson.zst

Note: Use environment variables for credentials to avoid exposing sensitive information in command history.

Note: The --lapis-url parameter is optional. If not provided, sr2silo uses default SARS-CoV-2 references (NC_045512.2). See sr2silo process-from-vpipe --help for details.

Environment Variable Configuration

sr2silo supports flexible configuration through environment variables, making it easy to use in different deployment scenarios including conda packages and pip installations.

Note: CLI parameters override environment variables

Common configuration via environment variables:

# Authentication credentials (recommended approach for security)
export KEYCLOAK_TOKEN_URL=https://auth.example.com/token
export BACKEND_URL=https://backend.example.com/api
export GROUP_ID=123
export USERNAME=your-username
export PASSWORD=your-password

# Run with environment variables set
sr2silo process-from-vpipe \
    --input-file input.bam \
    --sample-id SAMPLE_001 \
    --timeline-file /path/to/timeline.tsv \
    --output-fp output.ndjson

# Submission using environment variables for credentials
sr2silo submit-to-loculus \
    --processed-file output.ndjson.zst